Site Overview
The domain Modernfamilynightlysweepstakes.com was registered 9 years ago. The website is ranked n/a in the world . Here are more than n/a visitors and the pages are viewed up to n/a times for every day. Usually, it takes n/a seconds for the visitors to open the website. Based on current visitor traffic, you will know that the advertising revenue on the website will be able to reach n/a USD per day. The server of the website is being hosted in United States.
Domain Age: | 9 years |
---|---|
Global Rank: | - |
Primary Traffic: | - |
Site Status: | - |
Rating: | 2.5/5.0 Stars |
SEO Score: | 40.6% |
Load Time: | - |
Web Safety: | - |
Child Safety: | - |
Daily Visitors: | - |
Daily Pageviews: | - |
Daily Bandwidth: | - |
Daily AD Revenue: | - |
Website Worth: | - |
Theme Colors: | |
Server Location: | United States (IP Address: 159.135.22.126) |
Tags: | - |
Site Traffic
Daily Visitors (Last 90 days)
The chart below shows how many visitors visited the website Modernfamilynightlysweepstakes.com every day for the past 90 days. The last record was on n/a, and about n/a visitors visited this site.
Daily Visitors by Country / Region
Where are the visitors who visited the website Modernfamilynightlysweepstakes.com? Through the map below, you will know that most of the visitors to this site are from n/a, about n/a visitors per day. Top 0 countries / regions are displayed here.
Daily Visitors by Subdomain
Which subdomains visitors often go on Modernfamilynightlysweepstakes.com? Through the chart below, you will know that the subdomain n/a is very popular, about n/a visitors per day. Top 0 subdomains are displayed here.
Daily Visitors by Keyword
Which search keywords send traffic to the website Modernfamilynightlysweepstakes.com? Through the chart below, you will know that there are a lot of visitors to this site by searching the keyword "n/a", about n/a visitors per day. Top 0 keywords are displayed here.
Linking In
Some sites linking to the website Modernfamilynightlysweepstakes.com. Top 0 links are displayed here.
Linking Out
The website Modernfamilynightlysweepstakes.com linking to some sites. Top 0 links are displayed here.
Site Domain
Domain profile
Here is the domain information about Modernfamilynightlysweepstakes.com . Through the table below, you will know that the domain name was registered on Aug 8, 2014( 9 years ago) and will expire on Aug 8, 2024 , and was registered on the website icann.org , etc.
Domain Name: | Modernfamilynightlysweepstakes.com |
---|---|
Domain Age: | 9 years |
Time Left: | 3 months |
Domain Owner: | Intellectual Property Department |
Owner's Email: | [email protected] |
Name server: | |
Domain Status: | |
Updated Date: | 2023-07-09 |
Creation Date: | 2014-08-08 |
Expiration Date: | 2024-08-08 |
Sponsor: | CSC CORPORATE DOMAINS, INC. |
Sponsor URL: | https://icann.org |
Whois Server: | whois.corporatedomains.com |
Domain Whois
Domain Whois is a query and response protocol that is widely used for querying databases that store the registered users or assignees of a domain name. The following information is the Whois of the domain Modernfamilynightlysweepstakes.com. Whois Lookup
Loading...
DNS Record
The Domain Name System (DNS) is a hierarchical and decentralized naming system for computers, services, or other resources connected to the Internet or a private network. It associates various information with domain names assigned to each of the participating entities. The table below shows the DNS record for the domain name Modernfamilynightlysweepstakes.com.
Name Server
The table below shows the Name Server for the domain name Modernfamilynightlysweepstakes.com.
Site Server
Server Location
Where are Modernfamilynightlysweepstakes.com website's servers located? The server is being hosted in United States.
# | IP Address | Country / Region | City |
---|---|---|---|
1 | 159.135.22.126 | United States | - |
Site Content
SEO Related
The SEO related content of the website Modernfamilynightlysweepstakes.com.
Name | Content |
---|---|
Title: | Modern Family Sweepstakes |
Description: | Win an Awesome TV and Home Theater System courtesy of Modern Family Nightly! |
Keywords: | - |
Theme Colors
What are the main colors of the theme of the website Modernfamilynightlysweepstakes.com? Through the chart below, we know that the main color of the site is White.
Homepage Links
Here are 0 links on the homepage of Modernfamilynightlysweepstakes.com, including n/a internal link, n/a external link, and n/a other link (eg, Javascript).
W3C Html Validation
When we checked the HTML of the homepage of the website Modernfamilynightlysweepstakes.com, we found that it had 9 errors and 1 warning.
# | Type | Total |
---|---|---|
1 | Error | 9 |
2 | Warning | 1 |
Site Referrals
Other sites hosted on the same server
Which websites are stored on the same server as the website Modernfamilynightlysweepstakes.com? So far, we have found n/a websites on this server.
Other Sites Owned
Which websites are owned by the same person who owns that Modernfamilynightlysweepstakes.com website? The websites below are owned by the same owner or not.
Backward Links
Which websites are linking to the website Modernfamilynightlysweepstakes.com? The websites below are linking to it.
Similar Ranks
These websites which ranked between n/a and n/a on the web just before or after the website Modernfamilynightlysweepstakes.com.
Site Competitors
Which websites compete with the website Modernfamilynightlysweepstakes.com on the web? Here are n/a websites are similar to it.
Mobile Apps
Apple Apps
Here are n/a Apple apps related to the website Modernfamilynightlysweepstakes.com.
Android Apps
Here are n/a Android apps related to the website Modernfamilynightlysweepstakes.com.